PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014103
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 236aa    MW: 26395.4 Da    PI: 6.8027
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014103genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.92.7e-191156147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+ +Edell ++v+++G ++W++Iar ++ gR++k+c++rw + 
      Lus10014103 11 KGPWSHDEDELLQRLVQRHGARNWSLIARSVP-GRSGKSCRLRWCNQ 56
                     79******************************.***********985 PP

2Myb_DNA-binding61.22.2e-1965107347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEde++ +a+ ++G++ W+tIar ++ gRt++++k++w++ 
      Lus10014103  65 PFTPEEDEIITKAHSKYGNK-WATIARLLN-GRTDNSVKNHWNST 107
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.781661IPR017930Myb domain
SuperFamilySSF466891.37E-328104IPR009057Homeodomain-like
SMARTSM007175.4E-161059IPR001005SANT/Myb domain
PfamPF002491.4E-181156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-261264IPR009057Homeodomain-like
CDDcd001676.61E-151355No hitNo description
SMARTSM007171.3E-1662110IPR001005SANT/Myb domain
PROSITE profilePS5129422.33363112IPR017930Myb domain
PfamPF002493.5E-1665107IPR001005SANT/Myb domain
CDDcd001678.10E-1365108No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2465111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MDQDSAVDRV KGPWSHDEDE LLQRLVQRHG ARNWSLIARS VPGRSGKSCR LRWCNQLSPE  60
VEHRPFTPEE DEIITKAHSK YGNKWATIAR LLNGRTDNSV KNHWNSTLKR KHVVAFSDDE  120
RERQPEKKQA RTVSFSPESP SQSGSDVSDG VDVQTGNVTD DVSTELTLSL PGKRSADLLT  180
AEGKKSALET APFGSGMLAV LQEMIRKEVE SYMEGKEGEE IRNAVIERFR IGNLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-38101113104C-Myb DNA-Binding Domain
1msf_C2e-38101113104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012075857.12e-88PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-62MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A067LBP52e-88A0A067LBP5_JATCU; MYB family protein
STRINGGLYMA17G35620.11e-76(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-63myb domain protein 73